SCOPe 2.05: Domain d5awfg_: 5awf G:

Lineage for d5awfg_ (5awf G:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [231728] (5 PDB entries)

8. Domain d5awfg_: 5awf G: [279111]
   Other proteins in same PDB: d5awfb_, d5awff_
   automated match to d2zu0c_

Details for d5awfg_

PDB Entry: 5awf, 2.96 Å

PDB Description: crystal structure of sufb-sufc-sufd complex from escherichia coli

PDB Compounds: (G:) Probable ATP-dependent transporter sufC

SCOPe Domain Sequences for d5awfg_:

Sequence; same for both SEQRES and ATOM records:

>d5awfg_ c.37.1.0 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg
ygw

Timeline for d5awfg_:

• d5awfg_ is new in SCOPe 2.05-stable
  
• d5awfg_ appears in SCOPe 2.06
  
• d5awfg_ appears in the current release, SCOPe 2.08