Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (96 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [231728] (5 PDB entries) |
Domain d5awfg_: 5awf G: [279111] Other proteins in same PDB: d5awfb_, d5awff_ automated match to d2zu0c_ |
PDB Entry: 5awf (more details), 2.96 Å
SCOPe Domain Sequences for d5awfg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5awfg_ c.37.1.0 (G:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg ygw
Timeline for d5awfg_: