Lineage for d1ydd__ (1ydd -)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 302547Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 302548Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 302549Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 302550Protein Carbonic anhydrase [51071] (9 species)
  7. 302565Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (151 PDB entries)
  8. 302677Domain d1ydd__: 1ydd - [27911]
    complexed with azm, hg, zn; mutant

Details for d1ydd__

PDB Entry: 1ydd (more details), 2.1 Å

PDB Description: structural basis of inhibitor affinity to variants of human carbonic anhydrase ii

SCOP Domain Sequences for d1ydd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydd__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgsrttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasf

SCOP Domain Coordinates for d1ydd__:

Click to download the PDB-style file with coordinates for d1ydd__.
(The format of our PDB-style files is described here.)

Timeline for d1ydd__: