SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ydda_ (1ydd A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2067966Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2067967Protein Carbonic anhydrase [51071] (10 species)
  7. 2068005Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (646 PDB entries)
    Uniprot P00918
  8. 2068498Domain d1ydda_: 1ydd A: [27911]
    complexed with azm, hg, zn

Details for d1ydda_

PDB Entry: 1ydd (more details), 2.1 Å

PDB Description: structural basis of inhibitor affinity to variants of human carbonic anhydrase ii
PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1ydda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydda_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgsrttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasf

SCOPe Domain Coordinates for d1ydda_:

Click to download the PDB-style file with coordinates for d1ydda_.
(The format of our PDB-style files is described here.)

Timeline for d1ydda_: