Lineage for d5awfd_ (5awf D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871891Species Escherichia coli K-12 [TaxId:83333] [231728] (5 PDB entries)
  8. 2871900Domain d5awfd_: 5awf D: [279109]
    Other proteins in same PDB: d5awfb_, d5awff_
    automated match to d2zu0c_

Details for d5awfd_

PDB Entry: 5awf (more details), 2.96 Å

PDB Description: crystal structure of sufb-sufc-sufd complex from escherichia coli
PDB Compounds: (D:) Probable ATP-dependent transporter sufC

SCOPe Domain Sequences for d5awfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5awfd_ c.37.1.0 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkq

SCOPe Domain Coordinates for d5awfd_:

Click to download the PDB-style file with coordinates for d5awfd_.
(The format of our PDB-style files is described here.)

Timeline for d5awfd_: