SCOPe 2.05: Domain d5awff_: 5awf F:

Lineage for d5awff_ (5awf F:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.6: Stabilizer of iron transporter SufD [101960] (1 family)
   superhelix turns are made of two very long strands each

5. Family b.80.6.1: Stabilizer of iron transporter SufD [101961] (1 protein)
   this is a repeat family; one repeat unit is 1vh4 A:307-339 found in domain

6. Protein Stabilizer of iron transporter SufD [101962] (1 species)

7. Species Escherichia coli [TaxId:562] [101963] (3 PDB entries)

8. Domain d5awff_: 5awf F: [279107]
   Other proteins in same PDB: d5awfc_, d5awfd_, d5awfg_, d5awfh_
   automated match to d2zu0a_

Details for d5awff_

PDB Entry: 5awf, 2.96 Å

PDB Description: crystal structure of sufb-sufc-sufd complex from escherichia coli

PDB Compounds: (F:) FeS cluster assembly protein SufD

SCOPe Domain Sequences for d5awff_:

Sequence; same for both SEQRES and ATOM records:

>d5awff_ b.80.6.1 (F:) Stabilizer of iron transporter SufD {Escherichia coli [TaxId: 562]}
snalqqwhhlfeaegtkrspqaqqhlqqllrtglptrkhenwkytpleglinsqfvsiag
eispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpdaiqaevfl
hlteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaegaeatvie
hfvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaedatafshsfl
lggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrqlhktivsd
kgravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcshgatvgri
ddeqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpgg

Timeline for d5awff_:

• d5awff_ is new in SCOPe 2.05-stable
  
• d5awff_ appears in SCOPe 2.06
  
• d5awff_ appears in the current release, SCOPe 2.08