Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Corynebacterium sp. [TaxId:1720] [279066] (4 PDB entries) |
Domain d4zu3b_: 4zu3 B: [279103] automated match to d2ag5b_ complexed with 4sd, mg, so4 |
PDB Entry: 4zu3 (more details), 2.2 Å
SCOPe Domain Sequences for d4zu3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zu3b_ c.2.1.0 (B:) automated matches {Corynebacterium sp. [TaxId: 1720]} ngrlagkrvlltnadaymgeatvqvfeeegaeviadhtdltkvgaaeevveraghidvlv anfavdahfgvtvletdeelwqtayetivhplhricravlpqfyernkgkivvygsaaam ryqegalaystarfaqrgyvtalgpeaarhnvnvnfiaqhwtqnkeyfwperiatdefke dmarrvplgrlataredallalflasdesdfivgksiefdggwat
Timeline for d4zu3b_: