SCOPe 2.05: Domain d4zu3c_: 4zu3 C:

Lineage for d4zu3c_ (4zu3 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Corynebacterium sp. [TaxId:1720] [279066] (3 PDB entries)

8. Domain d4zu3c_: 4zu3 C: [279102]
   automated match to d2ag5b_
   complexed with 4sd, mg, so4

Details for d4zu3c_

PDB Entry: 4zu3, 2.2 Å

PDB Description: halohydrin hydrogen-halide-lyases, hheb

PDB Compounds: (C:) Halohydrin epoxidase B

SCOPe Domain Sequences for d4zu3c_:

Sequence; same for both SEQRES and ATOM records:

>d4zu3c_ c.2.1.0 (C:) automated matches {Corynebacterium sp. [TaxId: 1720]}
grlagkrvlltnadaymgeatvqvfeeegaeviadhtdltkvgaaeevveraghidvlva
nfavdahfgvtvletdeelwqtayetivhplhricravlpqfyernkgkivvygsaaamr
yqegalaystarfaqrgyvtalgpeaarhnvnvnfiaqhwtqnkeyfwperiatdefked
marrvplgrlataredallalflasdesdfivgksiefdggwat

Timeline for d4zu3c_:

• d4zu3c_ is new in SCOPe 2.05-stable
  
• d4zu3c_ appears in SCOPe 2.06
  
• d4zu3c_ appears in the current release, SCOPe 2.08