Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
Protein automated matches [190312] (9 species) not a true protein |
Species Zymomonas mobilis [TaxId:542] [255669] (5 PDB entries) |
Domain d4zp1c2: 4zp1 C:188-362 [279096] Other proteins in same PDB: d4zp1a1, d4zp1a3, d4zp1b1, d4zp1b3, d4zp1c1, d4zp1c3, d4zp1d1, d4zp1d3 automated match to d1zpda1 complexed with gol, mg, ni, tpp |
PDB Entry: 4zp1 (more details), 2.21 Å
SCOPe Domain Sequences for d4zp1c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zp1c2 c.31.1.0 (C:188-362) automated matches {Zymomonas mobilis [TaxId: 542]} easdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggavatmaaak sffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdpkklvla eprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadps
Timeline for d4zp1c2: