Lineage for d4zp1b2 (4zp1 B:188-362)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470834Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2470835Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2471274Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2471275Protein automated matches [190312] (14 species)
    not a true protein
  7. 2471389Species Zymomonas mobilis [TaxId:542] [255669] (6 PDB entries)
  8. 2471417Domain d4zp1b2: 4zp1 B:188-362 [279093]
    Other proteins in same PDB: d4zp1a1, d4zp1a3, d4zp1b1, d4zp1b3, d4zp1c1, d4zp1c3, d4zp1d1, d4zp1d3
    automated match to d1zpda1
    complexed with gol, mg, ni, tpp

Details for d4zp1b2

PDB Entry: 4zp1 (more details), 2.21 Å

PDB Description: crystal structure of zymomonas mobilis pyruvate decarboxylase variant glu473ala
PDB Compounds: (B:) pyruvate decarboxylase

SCOPe Domain Sequences for d4zp1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zp1b2 c.31.1.0 (B:188-362) automated matches {Zymomonas mobilis [TaxId: 542]}
easdeaslnaaveetlkfianrdkvavlvgsklraagaeeaavkfadalggavatmaaak
sffpeenphyigtswgevsypgvektmkeadavialapvfndysttgwtdipdpkklvla
eprsvvvngirfpsvhlkdyltrlaqkvskktgaldffkslnagelkkaapadps

SCOPe Domain Coordinates for d4zp1b2:

Click to download the PDB-style file with coordinates for d4zp1b2.
(The format of our PDB-style files is described here.)

Timeline for d4zp1b2: