| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
| Protein automated matches [227126] (21 species) not a true protein |
| Species Zymomonas mobilis [TaxId:542] [255668] (6 PDB entries) |
| Domain d4zp1a1: 4zp1 A:2-187 [279089] Other proteins in same PDB: d4zp1a2, d4zp1b2, d4zp1c2, d4zp1d2 automated match to d1zpda2 complexed with gol, mg, ni, tpp |
PDB Entry: 4zp1 (more details), 2.21 Å
SCOPe Domain Sequences for d4zp1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zp1a1 c.36.1.0 (A:2-187) automated matches {Zymomonas mobilis [TaxId: 542]}
sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
salfnd
Timeline for d4zp1a1: