Lineage for d4zp1a1 (4zp1 A:2-187)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2865204Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2865205Protein automated matches [227126] (21 species)
    not a true protein
  7. 2865622Species Zymomonas mobilis [TaxId:542] [255668] (6 PDB entries)
  8. 2865659Domain d4zp1a1: 4zp1 A:2-187 [279089]
    Other proteins in same PDB: d4zp1a2, d4zp1b2, d4zp1c2, d4zp1d2
    automated match to d1zpda2
    complexed with gol, mg, ni, tpp

Details for d4zp1a1

PDB Entry: 4zp1 (more details), 2.21 Å

PDB Description: crystal structure of zymomonas mobilis pyruvate decarboxylase variant glu473ala
PDB Compounds: (A:) pyruvate decarboxylase

SCOPe Domain Sequences for d4zp1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zp1a1 c.36.1.0 (A:2-187) automated matches {Zymomonas mobilis [TaxId: 542]}
sytvgtylaerlvqiglkhhfavagdynlvlldnlllnknmeqvyccnelncgfsaegya
rakgaaaavvtysvgalsafdaiggayaenlpvilisgapnnndhaaghvlhhalgktdy
hyqlemaknitaaaeaiytpeeapakidhviktalrekkpvyleiacniasmpcaapgpa
salfnd

SCOPe Domain Coordinates for d4zp1a1:

Click to download the PDB-style file with coordinates for d4zp1a1.
(The format of our PDB-style files is described here.)

Timeline for d4zp1a1: