Lineage for d4zf7b_ (4zf7 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992769Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1992770Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1992868Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1993023Protein automated matches [190501] (4 species)
    not a true protein
  7. 1993072Species Mustela putorius [TaxId:9669] [279075] (1 PDB entry)
  8. 1993074Domain d4zf7b_: 4zf7 B: [279077]
    automated match to d1irla_
    complexed with 1pe, peg, pg4, so4

Details for d4zf7b_

PDB Entry: 4zf7 (more details), 1.89 Å

PDB Description: crystal structure of ferret interleukin-2
PDB Compounds: (B:) Interleukin 2

SCOPe Domain Sequences for d4zf7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zf7b_ a.26.1.2 (B:) automated matches {Mustela putorius [TaxId: 9669]}
sstkeaqqqleqllldlqlllngvknyesprmltfkfympkkatelthlqclaeelklle
evlylaqsknfhltdikelmsninvtllklkgsetsfkceyddetvtiteflnkwitfcq
sifstlt

SCOPe Domain Coordinates for d4zf7b_:

Click to download the PDB-style file with coordinates for d4zf7b_.
(The format of our PDB-style files is described here.)

Timeline for d4zf7b_: