Class a: All alpha proteins [46456] (290 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
Protein automated matches [190501] (4 species) not a true protein |
Species Mustela putorius [TaxId:9669] [279075] (1 PDB entry) |
Domain d4zf7b_: 4zf7 B: [279077] automated match to d1irla_ complexed with 1pe, peg, pg4, so4 |
PDB Entry: 4zf7 (more details), 1.89 Å
SCOPe Domain Sequences for d4zf7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zf7b_ a.26.1.2 (B:) automated matches {Mustela putorius [TaxId: 9669]} sstkeaqqqleqllldlqlllngvknyesprmltfkfympkkatelthlqclaeelklle evlylaqsknfhltdikelmsninvtllklkgsetsfkceyddetvtiteflnkwitfcq sifstlt
Timeline for d4zf7b_: