![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
![]() | Protein automated matches [190501] (4 species) not a true protein |
![]() | Species Mustela putorius [TaxId:9669] [279075] (1 PDB entry) |
![]() | Domain d4zf7a_: 4zf7 A: [279076] automated match to d1irla_ complexed with 1pe, peg, pg4, so4 |
PDB Entry: 4zf7 (more details), 1.89 Å
SCOPe Domain Sequences for d4zf7a_:
Sequence, based on SEQRES records: (download)
>d4zf7a_ a.26.1.2 (A:) automated matches {Mustela putorius [TaxId: 9669]} ssstkeaqqqleqllldlqlllngvknyesprmltfkfympkkatelthlqclaeelkll eevlylaqsknfhltdikelmsninvtllklkgsetsfkceyddetvtiteflnkwitfc qsifstlt
>d4zf7a_ a.26.1.2 (A:) automated matches {Mustela putorius [TaxId: 9669]} ssstkeaqqqleqllldlqlllngvknyesprmltfkfympkkatelthlqclaeelkll eevlylaqskhltdikelmsninvtllklkgsetsfkceyddetvtiteflnkwitfcqs ifstlt
Timeline for d4zf7a_: