Lineage for d4zf7a_ (4zf7 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705721Protein automated matches [190501] (4 species)
    not a true protein
  7. 2705776Species Mustela putorius [TaxId:9669] [279075] (1 PDB entry)
  8. 2705777Domain d4zf7a_: 4zf7 A: [279076]
    automated match to d1irla_
    complexed with 1pe, peg, pg4, so4

Details for d4zf7a_

PDB Entry: 4zf7 (more details), 1.89 Å

PDB Description: crystal structure of ferret interleukin-2
PDB Compounds: (A:) Interleukin 2

SCOPe Domain Sequences for d4zf7a_:

Sequence, based on SEQRES records: (download)

>d4zf7a_ a.26.1.2 (A:) automated matches {Mustela putorius [TaxId: 9669]}
ssstkeaqqqleqllldlqlllngvknyesprmltfkfympkkatelthlqclaeelkll
eevlylaqsknfhltdikelmsninvtllklkgsetsfkceyddetvtiteflnkwitfc
qsifstlt

Sequence, based on observed residues (ATOM records): (download)

>d4zf7a_ a.26.1.2 (A:) automated matches {Mustela putorius [TaxId: 9669]}
ssstkeaqqqleqllldlqlllngvknyesprmltfkfympkkatelthlqclaeelkll
eevlylaqskhltdikelmsninvtllklkgsetsfkceyddetvtiteflnkwitfcqs
ifstlt

SCOPe Domain Coordinates for d4zf7a_:

Click to download the PDB-style file with coordinates for d4zf7a_.
(The format of our PDB-style files is described here.)

Timeline for d4zf7a_: