| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Corynebacterium sp. [TaxId:1720] [279066] (4 PDB entries) |
| Domain d4z9fd_: 4z9f D: [279070] automated match to d2ph3a_ complexed with cl |
PDB Entry: 4z9f (more details), 1.75 Å
SCOPe Domain Sequences for d4z9fd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z9fd_ c.2.1.0 (D:) automated matches {Corynebacterium sp. [TaxId: 1720]}
mkialvtharhfagpaavealtrdgytvvchdasfadaaerqrfesenpgtvalaeqkpe
rlvdatlqhgeaidtivsndyiprpmnrlpiegtseadirqvfealsifpilllqsaiap
lraaggasvifitssvgkkplaynplygparaatvalvesaaktlsrdgillyaigpnff
nnptyfptsdwennpelrerverdvplgrlgrpdemgalitflasrraapivgqffaftg
gylp
Timeline for d4z9fd_: