SCOP 1.65: Domain d1cal__: 1cal -

Lineage for d1cal__ (1cal -)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (9 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (151 PDB entries)

8. Domain d1cal__: 1cal - [27907]
   complexed with zn; mutant

Details for d1cal__

PDB Entry: 1cal, 2.2 Å

PDB Description: structural analysis of the zinc hydroxide-thr 199-glu 106 hydrogen bonding network in human carbonic anhydrase ii

SCOP Domain Sequences for d1cal__:

Sequence; same for both SEQRES and ATOM records:

>d1cal__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslatppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

Timeline for d1cal__:

• d1cal__ first appeared (with stable ids) in SCOP 1.55
  
• d1cal__ appears in SCOP 1.63
  
• d1cal__ appears in SCOP 1.67
  
• d1cal__ appears in the current release, SCOPe 2.08, called d1cala_