SCOPe 2.08: Domain d4ylbd1: 4ylb D:1-116

Lineage for d4ylbd1 (4ylb D:1-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.15.1: HSP20-like chaperones [49764] (5 families)

5. Family b.15.1.0: automated matches [191643] (1 protein)
   not a true family

6. Protein automated matches [191181] (10 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:555311] [279049] (3 PDB entries)

8. Domain d4ylbd1: 4ylb D:1-116 [279065]
   Other proteins in same PDB: d4ylba2, d4ylbb2, d4ylbc2, d4ylbd2
   automated match to d3aaca_
   complexed with cl; mutant

Details for d4ylbd1

PDB Entry: 4ylb, 2.5 Å

PDB Description: crystal structure of a102d mutant of hsp14.1 from sulfolobus solfatataricus p2

PDB Compounds: (D:) Heat shock protein Hsp20

SCOPe Domain Sequences for d4ylbd1:

Sequence, based on SEQRES records:

>d4ylbd1 b.15.1.0 (D:1-116) automated matches {Sulfolobus solfataricus [TaxId: 555311]}
mmnvimreigkkldelsrefyesvippidmyeeggelvvvadlagfnkdkisvrlsaqne
liinaereiqyigtkyatqrplkihkvirlpvkvkrdsqvtdkyengvltiripve

Sequence, based on observed residues (ATOM records):

>d4ylbd1 b.15.1.0 (D:1-116) automated matches {Sulfolobus solfataricus [TaxId: 555311]}
mmnvimreigkkldelsrefyesvippidmyeeggelvvvadlagfnkdkisvrlsaqne
liinaereiqyigtkyatqrplkihkvirlpvkvrdsqvtdkyengvltiripve

Timeline for d4ylbd1:

• d4ylbd1 first appeared in SCOPe 2.05, called d4ylbd_
  
• d4ylbd1 appears in SCOPe 2.07