Lineage for d2cab__ (2cab -)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 114637Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
  4. 114638Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 114639Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 114640Protein Carbonic anhydrase [51071] (9 species)
  7. 114655Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (144 PDB entries)
  8. 114753Domain d2cab__: 2cab - [27906]

Details for d2cab__

PDB Entry: 2cab (more details), 2 Å

PDB Description: structure, refinement and function of carbonic anhydrase isozymes. refinement of human carbonic anhydrase i

SCOP Domain Sequences for d2cab__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cab__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
sfhvnfednqdrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
nrptqplkgrtvrasf

SCOP Domain Coordinates for d2cab__:

Click to download the PDB-style file with coordinates for d2cab__.
(The format of our PDB-style files is described here.)

Timeline for d2cab__: