Lineage for d4ylca_ (4ylc A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776751Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1776752Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 1776847Family b.15.1.0: automated matches [191643] (1 protein)
    not a true family
  6. 1776848Protein automated matches [191181] (5 species)
    not a true protein
  7. 1776857Species Sulfolobus solfataricus [TaxId:555311] [279049] (3 PDB entries)
  8. 1776866Domain d4ylca_: 4ylc A: [279053]
    automated match to d3aaca_
    complexed with cl; mutant

Details for d4ylca_

PDB Entry: 4ylc (more details), 3.1 Å

PDB Description: crystal structure of del-c4 mutant of hsp14.1 from sulfolobus solfatataricus p2
PDB Compounds: (A:) Heat shock protein Hsp20

SCOPe Domain Sequences for d4ylca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ylca_ b.15.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 555311]}
pgtmmnvimreigkkldelsrefyesvippidmyeeggelvvvadlagfnkdkisvrlsa
qneliinaereiqyigtkyatqrplkihkvirlpvkvkrdsqvtakyengvltiripveg
svs

SCOPe Domain Coordinates for d4ylca_:

Click to download the PDB-style file with coordinates for d4ylca_.
(The format of our PDB-style files is described here.)

Timeline for d4ylca_: