Lineage for d4ylca1 (4ylc A:1-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773837Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773838Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 2773941Family b.15.1.0: automated matches [191643] (1 protein)
    not a true family
  6. 2773942Protein automated matches [191181] (10 species)
    not a true protein
  7. 2773960Species Sulfolobus solfataricus [TaxId:555311] [279049] (3 PDB entries)
  8. 2773969Domain d4ylca1: 4ylc A:1-120 [279053]
    Other proteins in same PDB: d4ylca2, d4ylcb2, d4ylcc2, d4ylcd2, d4ylce2, d4ylcf2, d4ylcg2, d4ylch2
    automated match to d3aaca_
    complexed with cl; mutant

Details for d4ylca1

PDB Entry: 4ylc (more details), 3.1 Å

PDB Description: crystal structure of del-c4 mutant of hsp14.1 from sulfolobus solfatataricus p2
PDB Compounds: (A:) Heat shock protein Hsp20

SCOPe Domain Sequences for d4ylca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ylca1 b.15.1.0 (A:1-120) automated matches {Sulfolobus solfataricus [TaxId: 555311]}
mmnvimreigkkldelsrefyesvippidmyeeggelvvvadlagfnkdkisvrlsaqne
liinaereiqyigtkyatqrplkihkvirlpvkvkrdsqvtakyengvltiripvegsvs

SCOPe Domain Coordinates for d4ylca1:

Click to download the PDB-style file with coordinates for d4ylca1.
(The format of our PDB-style files is described here.)

Timeline for d4ylca1: