Lineage for d4xe3a_ (4xe3 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005877Species Streptomyces antibioticus [TaxId:1890] [279042] (1 PDB entry)
  8. 2005878Domain d4xe3a_: 4xe3 A: [279044]
    automated match to d2zbza_
    complexed with cl6, hem, so4

Details for d4xe3a_

PDB Entry: 4xe3 (more details), 2.65 Å

PDB Description: olep, the cytochrome p450 epoxidase from streptomyces antibioticus involved in oleandomycin biosynthesis: functional analysis and crystallographic structure in complex with clotrimazole.
PDB Compounds: (A:) Cytochrome P-450

SCOPe Domain Sequences for d4xe3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xe3a_ a.104.1.0 (A:) automated matches {Streptomyces antibioticus [TaxId: 1890]}
vpaypfslphaldldphyaelrrdepvsrvrlpygegtawlvtrmsdarivlgdsrfsta
aatdpatprmfptppepdgvlaqdppdhtrlrrlvgkaftarrveemrprvrslvdslld
dmvahgspadlveflavpfpvavicellgvpledrdlfrtfsdamlsstrltaaeiqrvq
qdfmvymdglvaqrrdaptedllgalalatdnddhltkgeivnmgvslliaghetsvnqi
tnlvhlllterkryeslvadpalvpaaveemlrytplvsagsfvrvatedvelstvtvra
gepcvvhfasanrdeevfdhadeldfhrernphiafghgahhcigaqlgrlelqealsal
vrrfptldlaepvaglkwkqgmlirglerqivsw

SCOPe Domain Coordinates for d4xe3a_:

Click to download the PDB-style file with coordinates for d4xe3a_.
(The format of our PDB-style files is described here.)

Timeline for d4xe3a_: