SCOPe 2.08: Domain d4xivb2: 4xiv B:355-540

Lineage for d4xivb2 (4xiv B:355-540)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.3: Histidine kinase [55884] (8 proteins)

6. Protein Histidine kinase CheA [55887] (2 species)

7. Species Thermotoga maritima [TaxId:243274] [360831] (2 PDB entries)

8. Domain d4xivb2: 4xiv B:355-540 [279041]
   Other proteins in same PDB: d4xiva1, d4xivb1
   automated match to d1b3qa3
   complexed with acp, adp

Details for d4xivb2

PDB Entry: 4xiv, 3 Å

PDB Description: kinase and dimerization (p3p4) of the thermotoga maritima chea kinase

PDB Compounds: (B:) chemotaxis protein chea

SCOPe Domain Sequences for d4xivb2:

Sequence; same for both SEQRES and ATOM records:

>d4xivb2 d.122.1.3 (B:355-540) Histidine kinase CheA {Thermotoga maritima [TaxId: 243274]}
mvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaidhg
iepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglideska
atlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgtkvt
irlplt

Timeline for d4xivb2:

• d4xivb2 first appeared in SCOPe 2.05
  
• d4xivb2 appears in SCOPe 2.07