Lineage for d4xivb1 (4xiv B:289-354)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709045Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 2709085Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) (S)
  5. 2709103Family a.30.2.0: automated matches [227712] (1 protein)
    not a true family
  6. 2709104Protein automated matches [227713] (2 species)
    not a true protein
  7. 2709120Species Thermotoga maritima [TaxId:243274] [227714] (7 PDB entries)
  8. 2709132Domain d4xivb1: 4xiv B:289-354 [279040]
    Other proteins in same PDB: d4xiva2, d4xivb2
    automated match to d1b3qa1
    complexed with acp, adp

Details for d4xivb1

PDB Entry: 4xiv (more details), 3 Å

PDB Description: kinase and dimerization (p3p4) of the thermotoga maritima chea kinase
PDB Compounds: (B:) chemotaxis protein chea

SCOPe Domain Sequences for d4xivb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xivb1 a.30.2.0 (B:289-354) automated matches {Thermotoga maritima [TaxId: 243274]}
kkvisqtvrvdiekldnlmdlmgelviarsriletlkkynikeldeslshlsritldlqn
vvmkir

SCOPe Domain Coordinates for d4xivb1:

Click to download the PDB-style file with coordinates for d4xivb1.
(The format of our PDB-style files is described here.)

Timeline for d4xivb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xivb2