SCOPe 2.07: Domain d4xiva1: 4xiv A:291-354

Lineage for d4xiva1 (4xiv A:291-354)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families)

5. Family a.30.2.0: automated matches [227712] (1 protein)
   not a true family

6. Protein automated matches [227713] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [227714] (5 PDB entries)

8. Domain d4xiva1: 4xiv A:291-354 [279038]
   Other proteins in same PDB: d4xiva2, d4xivb2
   automated match to d1b3qa1
   complexed with acp, adp

Details for d4xiva1

PDB Entry: 4xiv, 3 Å

PDB Description: kinase and dimerization (p3p4) of the thermotoga maritima chea kinase

PDB Compounds: (A:) chemotaxis protein chea

SCOPe Domain Sequences for d4xiva1:

Sequence; same for both SEQRES and ATOM records:

>d4xiva1 a.30.2.0 (A:291-354) automated matches {Thermotoga maritima [TaxId: 243274]}
visqtvrvdiekldnlmdlmgelviarsriletlkkynikeldeslshlsritldlqnvv
mkir

Timeline for d4xiva1:

• d4xiva1 first appeared in SCOPe 2.05
  
• d4xiva1 appears in SCOPe 2.06