![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
![]() | Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) ![]() |
![]() | Family a.30.2.0: automated matches [227712] (1 protein) not a true family |
![]() | Protein automated matches [227713] (2 species) not a true protein |
![]() | Species Thermotoga maritima [TaxId:243274] [227714] (7 PDB entries) |
![]() | Domain d4xiva1: 4xiv A:291-354 [279038] Other proteins in same PDB: d4xiva2, d4xivb2 automated match to d1b3qa1 complexed with acp, adp |
PDB Entry: 4xiv (more details), 3 Å
SCOPe Domain Sequences for d4xiva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xiva1 a.30.2.0 (A:291-354) automated matches {Thermotoga maritima [TaxId: 243274]} visqtvrvdiekldnlmdlmgelviarsriletlkkynikeldeslshlsritldlqnvv mkir
Timeline for d4xiva1: