SCOPe 2.07: Domain d4xbsa_: 4xbs A:

Lineage for d4xbsa_ (4xbs A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (91 species)
   not a true protein

7. Species Lactobacillus brevis [TaxId:649758] [279033] (2 PDB entries)

8. Domain d4xbsa_: 4xbs A: [279035]
   automated match to d3ng3d_
   mutant

Details for d4xbsa_

PDB Entry: 4xbs, 2.17 Å

PDB Description: 2-deoxyribose-5-phosphate aldolase mutant - e78k

PDB Compounds: (A:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d4xbsa_:

Sequence; same for both SEQRES and ATOM records:

>d4xbsa_ c.1.10.0 (A:) automated matches {Lactobacillus brevis [TaxId: 649758]}
ltteqlakyidhtnlkadateadikqtcdeakkfntasvcvnsywipfvteqlkgtdvnp
iavvgfplgamateskifeattaidqgaeeidmvlnvgelkggndekvladiqgladavh
akgkilkvilenalltkdeivracqlsekagadfvktstgfstsgakvedvklmretvgd
rlgvkasggihsreealamidagasrmgvsatvailt

Timeline for d4xbsa_:

• d4xbsa_ first appeared in SCOPe 2.05
  
• d4xbsa_ appears in SCOPe 2.06
  
• d4xbsa_ appears in the current release, SCOPe 2.08