SCOPe 2.05: Domain d4wtya_: 4wty A:

Lineage for d4wtya_ (4wty A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.4: Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117583] (2 proteins)

6. Protein automated matches [226916] (1 species)
   not a true protein

7. Species Selenomonas ruminantium [TaxId:971] [225167] (6 PDB entries)

8. Domain d4wtya_: 4wty A: [279030]
   automated match to d3o3la_
   complexed with 4ip, cl, gol

Details for d4wtya_

PDB Entry: 4wty, 2.1 Å

PDB Description: structure of the ptp-like myo-inositol phosphatase from selenomonas ruminantium in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate

PDB Compounds: (A:) myo-inositol phosphohydrolase

SCOPe Domain Sequences for d4wtya_:

Sequence; same for both SEQRES and ATOM records:

>d4wtya_ c.45.1.4 (A:) automated matches {Selenomonas ruminantium [TaxId: 971]}
qtvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvp
sregmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswyger
dwanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaa
gmryfriaatdhvwptpenidrflafyrtlpqdawlhfhseagvgrttafmvmtdmlknp
svslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyq
tpwsvwlkshpaka

Timeline for d4wtya_:

• d4wtya_ is new in SCOPe 2.05-stable
  
• d4wtya_ appears in SCOPe 2.06
  
• d4wtya_ appears in the current release, SCOPe 2.08