Lineage for d4wtyb_ (4wty B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851756Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1851757Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1852093Family c.45.1.4: Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117583] (2 proteins)
  6. 1852117Protein automated matches [226916] (1 species)
    not a true protein
  7. 1852118Species Selenomonas ruminantium [TaxId:971] [225167] (6 PDB entries)
  8. 1852128Domain d4wtyb_: 4wty B: [279029]
    automated match to d3o3la_
    complexed with 4ip, cl, gol

Details for d4wtyb_

PDB Entry: 4wty (more details), 2.1 Å

PDB Description: structure of the ptp-like myo-inositol phosphatase from selenomonas ruminantium in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate
PDB Compounds: (B:) myo-inositol phosphohydrolase

SCOPe Domain Sequences for d4wtyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wtyb_ c.45.1.4 (B:) automated matches {Selenomonas ruminantium [TaxId: 971]}
qtvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvp
sregmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswyger
dwanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaa
gmryfriaatdhvwptpenidrflafyrtlpqdawlhfhseagvgrttafmvmtdmlknp
svslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyq
tpwsvwlkshpaka

SCOPe Domain Coordinates for d4wtyb_:

Click to download the PDB-style file with coordinates for d4wtyb_.
(The format of our PDB-style files is described here.)

Timeline for d4wtyb_: