Lineage for d4wpta1 (4wpt A:1-244)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2527952Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2527953Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2528067Family c.109.1.0: automated matches [227144] (1 protein)
    not a true family
  6. 2528068Protein automated matches [226847] (5 species)
    not a true protein
  7. 2528090Species Mycobacterium tuberculosis [TaxId:419947] [260615] (8 PDB entries)
  8. 2528091Domain d4wpta1: 4wpt A:1-244 [279025]
    Other proteins in same PDB: d4wpta2, d4wpta3
    automated match to d4wiua1
    complexed with gol, pep, po4

Details for d4wpta1

PDB Entry: 4wpt (more details), 1.6 Å

PDB Description: crystal structure of mtb pepck in complex with pep
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d4wpta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wpta1 c.109.1.0 (A:1-244) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
mtsatipgldtaptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtfir
lnpekhknsylalsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrgcm
rgrtmyvvpfcmgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvkal
hsvgaplepgqkdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasama
hdeg

SCOPe Domain Coordinates for d4wpta1:

Click to download the PDB-style file with coordinates for d4wpta1.
(The format of our PDB-style files is described here.)

Timeline for d4wpta1: