SCOPe 2.05: Domain d4wpta1: 4wpt A:-1-244

Lineage for d4wpta1 (4wpt A:-1-244)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.0: automated matches [227144] (1 protein)
   not a true family

6. Protein automated matches [226847] (5 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:419947] [260615] (7 PDB entries)

8. Domain d4wpta1: 4wpt A:-1-244 [279025]
   Other proteins in same PDB: d4wpta2
   automated match to d4wiua1
   complexed with gol, pep, po4

Details for d4wpta1

PDB Entry: 4wpt, 1.6 Å

PDB Description: crystal structure of mtb pepck in complex with pep

PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d4wpta1:

Sequence; same for both SEQRES and ATOM records:

>d4wpta1 c.109.1.0 (A:-1-244) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
shmtsatipgldtaptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtf
irlnpekhknsylalsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrg
cmrgrtmyvvpfcmgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvk
alhsvgaplepgqkdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasa
mahdeg

Timeline for d4wpta1:

• d4wpta1 is new in SCOPe 2.05-stable
  
• d4wpta1 appears in SCOPe 2.06
  
• d4wpta1 appears in the current release, SCOPe 2.08