SCOPe 2.05: Domain d4woua2: 4wou A:245-606

Lineage for d4woua2 (4wou A:245-606)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
   contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side

4. Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families)

5. Family c.91.1.0: automated matches [196141] (1 protein)
   not a true family

6. Protein automated matches [196142] (6 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:419947] [260617] (7 PDB entries)

8. Domain d4woua2: 4wou A:245-606 [279023]
   Other proteins in same PDB: d4woua1
   automated match to d4wiua2
   complexed with gdp, gol, mn, po4, zn

Details for d4woua2

PDB Entry: 4wou, 2.12 Å

PDB Description: crystal structure of mtb pepck in complex with gdp and metals

PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d4woua2:

Sequence; same for both SEQRES and ATOM records:

>d4woua2 c.91.1.0 (A:245-606) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
wlaehmlilklispenkayyfaaafpsacgktnlamlqptipgwraetlgddiawmrfgk
dgrlyavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweglegdpq
hlidwkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfggrrktt
vplvteardwqhgvfigatlgseqtaaaegkvgnvrrdpmamlpflgynvgdyfqhwinl
gkhadesklpkvffvnwfrrgddgrflwpgfgensrvlkwivdriehkaggattpigtvp
avedldldgldvdaadvaaalavdadewrqelplieewlqfvgeklptgvkdefdalker
lg

Timeline for d4woua2:

• d4woua2 is new in SCOPe 2.05-stable
  
• d4woua2 appears in SCOPe 2.06
  
• d4woua2 appears in the current release, SCOPe 2.08