Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) |
Family c.109.1.0: automated matches [227144] (1 protein) not a true family |
Protein automated matches [226847] (5 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:419947] [260615] (8 PDB entries) |
Domain d4wpva1: 4wpv A:13-244 [279021] Other proteins in same PDB: d4wpva2 automated match to d4wiua1 complexed with gol, po4, zn; mutant |
PDB Entry: 4wpv (more details), 1.67 Å
SCOPe Domain Sequences for d4wpva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wpva1 c.109.1.0 (A:13-244) automated matches {Mycobacterium tuberculosis [TaxId: 419947]} ptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtfirlnpekhknsyla lsdpsdvarvasrtyicsakeidagptnnwmdpgemrsimkdlyrgcmrgrtmyvvpfcm gplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvkalhsvgaplepgqk dvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasamahdeg
Timeline for d4wpva1: