![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [331472] (6 PDB entries) |
![]() | Domain d4rzca_: 4rzc A: [279014] Other proteins in same PDB: d4rzcb_, d4rzcd_, d4rzcf_, d4rzcl_ automated match to d4kfzc_ complexed with m6p, so4 |
PDB Entry: 4rzc (more details), 2.72 Å
SCOPe Domain Sequences for d4rzca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rzca_ b.1.1.1 (A:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} asqsvkesegdlvkpgasltltckasgfdftwytmnwvrqapgkglewiasigagvygsn yyaswakgrftiskassttvtlqmtsltvadtatyfcardginggydiwgpgtlvtvss
Timeline for d4rzca_: