| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [331472] (6 PDB entries) |
| Domain d4rzce_: 4rzc E: [279012] Other proteins in same PDB: d4rzcb_, d4rzcd_, d4rzcf_, d4rzcl_ automated match to d4kfzc_ complexed with m6p, so4 |
PDB Entry: 4rzc (more details), 2.72 Å
SCOPe Domain Sequences for d4rzce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rzce_ b.1.1.1 (E:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qsvkesegdlvkpgasltltckasgfdftwytmnwvrqapgkglewiasigagvygsnyy
aswakgrftiskassttvtlqmtsltvadtatyfcardginggydiwgpgtlvtvss
Timeline for d4rzce_: