Lineage for d4pitd1 (4pit D:1-141)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2402521Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2402563Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2402707Family b.77.3.0: automated matches [191397] (1 protein)
    not a true family
  6. 2402708Protein automated matches [190516] (5 species)
    not a true protein
  7. 2402709Species Musa acuminata [TaxId:4641] [187471] (10 PDB entries)
  8. 2402713Domain d4pitd1: 4pit D:1-141 [279004]
    Other proteins in same PDB: d4pita2, d4pitb2, d4pitc2, d4pitd2
    automated match to d2bmza_
    complexed with gol, man

Details for d4pitd1

PDB Entry: 4pit (more details), 1.55 Å

PDB Description: crystal structure of banana lectin h84t bound to dimannose
PDB Compounds: (D:) ripening-associated protein

SCOPe Domain Sequences for d4pitd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pitd1 b.77.3.0 (D:1-141) automated matches {Musa acuminata [TaxId: 4641]}
mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
tpheivlqegeylvgmagevanytgavvlgklgfstnkkaygpfgntggtpfslpiaagk
isgffgrggkfldaigvylep

SCOPe Domain Coordinates for d4pitd1:

Click to download the PDB-style file with coordinates for d4pitd1.
(The format of our PDB-style files is described here.)

Timeline for d4pitd1: