Class b: All beta proteins [48724] (180 folds) |
Fold b.77: beta-Prism I [51091] (4 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) |
Family b.77.3.0: automated matches [191397] (1 protein) not a true family |
Protein automated matches [190516] (5 species) not a true protein |
Species Musa acuminata [TaxId:4641] [187471] (10 PDB entries) |
Domain d4pitc1: 4pit C:3-141 [279003] Other proteins in same PDB: d4pita2, d4pitb2, d4pitc2, d4pitd2 automated match to d2bmza_ complexed with gol, man |
PDB Entry: 4pit (more details), 1.55 Å
SCOPe Domain Sequences for d4pitc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pitc1 b.77.3.0 (C:3-141) automated matches {Musa acuminata [TaxId: 4641]} gaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsggtp heivlqegeylvgmagevanytgavvlgklgfstnkkaygpfgntggtpfslpiaagkis gffgrggkfldaigvylep
Timeline for d4pitc1: