SCOPe 2.08: Domain d4pita1: 4pit A:4-141

Lineage for d4pita1 (4pit A:4-141)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.77: beta-Prism I [51091] (4 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.0: automated matches [191397] (1 protein)
   not a true family

6. Protein automated matches [190516] (5 species)
   not a true protein

7. Species Musa acuminata [TaxId:4641] [187471] (10 PDB entries)

8. Domain d4pita1: 4pit A:4-141 [279002]
   Other proteins in same PDB: d4pita2, d4pitb2, d4pitc2, d4pitd2
   automated match to d2bmza_
   complexed with gol, man

Details for d4pita1

PDB Entry: 4pit, 1.55 Å

PDB Description: crystal structure of banana lectin h84t bound to dimannose

PDB Compounds: (A:) ripening-associated protein

SCOPe Domain Sequences for d4pita1:

Sequence; same for both SEQRES and ATOM records:

>d4pita1 b.77.3.0 (A:4-141) automated matches {Musa acuminata [TaxId: 4641]}
aikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsggtph
eivlqegeylvgmagevanytgavvlgklgfstnkkaygpfgntggtpfslpiaagkisg
ffgrggkfldaigvylep

Timeline for d4pita1:

• d4pita1 first appeared in SCOPe 2.05, called d4pita_
  
• d4pita1 appears in SCOPe 2.07