SCOPe 2.06: Domain d4piub1: 4piu B:1-141

Lineage for d4piub1 (4piu B:1-141)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.0: automated matches [191397] (1 protein)
   not a true family

6. Protein automated matches [190516] (4 species)
   not a true protein

7. Species Musa acuminata [TaxId:4641] [187471] (10 PDB entries)

8. Domain d4piub1: 4piu B:1-141 [279001]
   Other proteins in same PDB: d4piua2, d4piub2
   automated match to d2bmza_
   complexed with gol, na; mutant

Details for d4piub1

PDB Entry: 4piu, 1.6 Å

PDB Description: crystal structure of banana lectin h84t mutant

PDB Compounds: (B:) ripening-associated protein

SCOPe Domain Sequences for d4piub1:

Sequence; same for both SEQRES and ATOM records:

>d4piub1 b.77.3.0 (B:1-141) automated matches {Musa acuminata [TaxId: 4641]}
mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
tpheivlqegeylvgmagevanytgavvlgklgfstnkkaygpfgntggtpfslpiaagk
isgffgrggkfldaigvylep

Timeline for d4piub1:

• d4piub1 first appeared in SCOPe 2.05, called d4piub_
  
• d4piub1 appears in SCOPe 2.07
  
• d4piub1 appears in the current release, SCOPe 2.08