Lineage for d4piub_ (4piu B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1805894Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 1805934Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 1806050Family b.77.3.0: automated matches [191397] (1 protein)
    not a true family
  6. 1806051Protein automated matches [190516] (2 species)
    not a true protein
  7. 1806052Species Musa acuminata [TaxId:4641] [187471] (10 PDB entries)
  8. 1806058Domain d4piub_: 4piu B: [279001]
    automated match to d2bmza_
    complexed with gol, na; mutant

Details for d4piub_

PDB Entry: 4piu (more details), 1.6 Å

PDB Description: crystal structure of banana lectin h84t mutant
PDB Compounds: (B:) ripening-associated protein

SCOPe Domain Sequences for d4piub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4piub_ b.77.3.0 (B:) automated matches {Musa acuminata [TaxId: 4641]}
mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
tpheivlqegeylvgmagevanytgavvlgklgfstnkkaygpfgntggtpfslpiaagk
isgffgrggkfldaigvylepl

SCOPe Domain Coordinates for d4piub_:

Click to download the PDB-style file with coordinates for d4piub_.
(The format of our PDB-style files is described here.)

Timeline for d4piub_: