Lineage for d5fktb2 (5fkt B:449-765)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2809651Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families) (S)
    duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378)
  5. 2809665Family b.69.13.0: automated matches [227242] (1 protein)
    not a true family
  6. 2809666Protein automated matches [227008] (11 species)
    not a true protein
  7. 2809672Species Cellvibrio japonicus [TaxId:498211] [278979] (4 PDB entries)
  8. 2809676Domain d5fktb2: 5fkt B:449-765 [278987]
    Other proteins in same PDB: d5fktb3
    automated match to d3a0fa2
    complexed with br, edo, k

Details for d5fktb2

PDB Entry: 5fkt (more details), 1.52 Å

PDB Description: unraveling the first step of xyloglucan degradation by the soil saprophyte cellvibrio japonicus through the functional and structural characterization of a potent gh74 endo-xyloglucanase
PDB Compounds: (B:) endo-1,4-beta-glucanase/xyloglucanase, gly74a

SCOPe Domain Sequences for d5fktb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fktb2 b.69.13.0 (B:449-765) automated matches {Cellvibrio japonicus [TaxId: 498211]}
gqillkpmvkgleetavldvvsppvgapvysalgaiggfrhddltkvptsmyttpnfsst
tsidfaelqpatmvrvgnldsgggigvttnaggswwqgqnppgvtsggnvalaadggaiv
wapggstnvylsttfgstwtaisalpagavieadrvnpnkfyalangtfyvstnkgasfs
atvtagipaaarkfkavygregdiwlaggsstttyglwrstnsgasftklasvqeadnvt
fgkaatgatypaiyiigkvdnvrgvfrstnegaswvrinddqrqygnfgeaisgdpriyg
rlylgtngrgllygdsa

SCOPe Domain Coordinates for d5fktb2:

Click to download the PDB-style file with coordinates for d5fktb2.
(The format of our PDB-style files is described here.)

Timeline for d5fktb2: