SCOPe 2.07: Domain d1heda_: 1hed A:

Lineage for d1heda_ (1hed A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (971 PDB entries)
   Uniprot P00918

8. Domain d1heda_: 1hed A: [27898]
   complexed with hg, zn

Details for d1heda_

PDB Entry: 1hed, 2 Å

PDB Description: structural consequences of hydrophilic amino-acid substitutions in the hydrophobic pocket of human carbonic anhydrase ii

PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1heda_:

Sequence; same for both SEQRES and ATOM records:

>d1heda_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
afnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhwn
tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
pesldywtypgsattppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
rpaqplknrqikasf

Timeline for d1heda_:

• d1heda_ first appeared (with stable ids) in SCOP 1.55, called d1hed__
  
• d1heda_ appears in SCOPe 2.06
  
• d1heda_ appears in the current release, SCOPe 2.08