SCOPe 2.08: Domain d5ealb_: 5eal B:

Lineage for d5ealb_ (5eal B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families)
   also contains 8-bladed propellers

5. Family b.69.4.0: automated matches [191412] (1 protein)
   not a true family

6. Protein automated matches [190568] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187559] (94 PDB entries)

8. Domain d5ealb_: 5eal B: [278978]
   automated match to d2h9la_
   complexed with 5ml, cl, edo, gol, unx

Details for d5ealb_

PDB Entry: 5eal, 1.8 Å

PDB Description: crystal structure of human wdr5 in complex with compound 9h

PDB Compounds: (B:) WD repeat-containing protein 5

SCOPe Domain Sequences for d5ealb_:

Sequence; same for both SEQRES and ATOM records:

>d5ealb_ b.69.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklgi
sdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsfd
esvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktli
dddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvtg
gkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktiklw
ksdc

Timeline for d5ealb_:

• d5ealb_ first appeared in SCOPe 2.05
  
• d5ealb_ appears in SCOPe 2.07