Lineage for d5eapa1 (5eap A:24-334)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2066122Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2066123Protein automated matches [190568] (6 species)
    not a true protein
  7. 2066160Species Human (Homo sapiens) [TaxId:9606] [187559] (46 PDB entries)
  8. 2066206Domain d5eapa1: 5eap A:24-334 [278976]
    Other proteins in same PDB: d5eapa2
    automated match to d2h9la_
    complexed with 5mo, cl, edo, gol, unx

Details for d5eapa1

PDB Entry: 5eap (more details), 1.73 Å

PDB Description: crystal structure of human wdr5 in complex with compound 9e
PDB Compounds: (A:) WD repeat-containing protein 5

SCOPe Domain Sequences for d5eapa1:

Sequence, based on SEQRES records: (download)

>d5eapa1 b.69.4.0 (A:24-334) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqskptpvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfekti
sghklgisdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnl
ivsgsfdesvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasg
qclktlidddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycif
anfsvtggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalen
dktiklwksdc

Sequence, based on observed residues (ATOM records): (download)

>d5eapa1 b.69.4.0 (A:24-334) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqskptpvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfekti
sghklgisdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnl
ivsgsfdesvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasg
qclktlidnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifan
fsvtggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendk
tiklwksdc

SCOPe Domain Coordinates for d5eapa1:

Click to download the PDB-style file with coordinates for d5eapa1.
(The format of our PDB-style files is described here.)

Timeline for d5eapa1:

  • d5eapa1 first appeared in SCOPe 2.05, called d5eapa_

View in 3D
Domains from same chain:
(mouse over for more information)
d5eapa2