Lineage for d5dk6a1 (5dk6 A:1-241)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2140829Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2141796Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2141797Protein automated matches [190781] (41 species)
    not a true protein
  7. 2141894Species Colwellia psychrerythraea [TaxId:167879] [278968] (1 PDB entry)
  8. 2141895Domain d5dk6a1: 5dk6 A:1-241 [278969]
    Other proteins in same PDB: d5dk6a2
    automated match to d4jwta_
    complexed with ade, gly

Details for d5dk6a1

PDB Entry: 5dk6 (more details), 2.27 Å

PDB Description: crystal structure of a 5'-methylthioadenosine/s-adenosylhomocysteine (mta/sah) nucleosidase (mtan) from colwellia psychrerythraea 34h (cps_4743, target psi-029300) in complex with adenine at 2.27 a resolution
PDB Compounds: (A:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d5dk6a1:

Sequence, based on SEQRES records: (download)

>d5dk6a1 c.56.2.0 (A:1-241) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
mkagiigamepevailkekltdakstehagytfhqgqldgsdvvivqsgigkvaaalata
ilidrfqvdyvvntgsaggfdaslkvgdivvssevryhdvdltafgyeigqlpanpaafm
phddlvaaakkgieqlsqtagenikavtglittgdtfmtkeedvakaranfptmaaveme
gaaiaqaclqlktpfvvirslsdiagkesphtfeeyletaavnssqlvlnmlgqlkgkvl
s

Sequence, based on observed residues (ATOM records): (download)

>d5dk6a1 c.56.2.0 (A:1-241) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
mkagiigamepevailkekltdakstehagytfhqgqldgsdvvivqsgigkvaaalata
ilidrfqvdyvvntgsaggfdaslkvgdivvssevryhdvdltafgyeigqlpanpaafm
phddlvaaakkgieqlsqnikavtglittgdtfmtkeedvakaranfptmaavemegaai
aqaclqlktpfvvirslsdiagkesphtfeeyletaavnssqlvlnmlgqlkgkvls

SCOPe Domain Coordinates for d5dk6a1:

Click to download the PDB-style file with coordinates for d5dk6a1.
(The format of our PDB-style files is described here.)

Timeline for d5dk6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5dk6a2