SCOPe 2.05: Domain d5dk6a_: 5dk6 A:

Lineage for d5dk6a_ (5dk6 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (36 species)
   not a true protein

7. Species Colwellia psychrerythraea [TaxId:167879] [278968] (1 PDB entry)

8. Domain d5dk6a_: 5dk6 A: [278969]
   automated match to d4jwta_
   complexed with ade, gly

Details for d5dk6a_

PDB Entry: 5dk6, 2.27 Å

PDB Description: crystal structure of a 5'-methylthioadenosine/s-adenosylhomocysteine (mta/sah) nucleosidase (mtan) from colwellia psychrerythraea 34h (cps_4743, target psi-029300) in complex with adenine at 2.27 a resolution

PDB Compounds: (A:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d5dk6a_:

Sequence, based on SEQRES records:

>d5dk6a_ c.56.2.0 (A:) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
lyfqsmkagiigamepevailkekltdakstehagytfhqgqldgsdvvivqsgigkvaa
alatailidrfqvdyvvntgsaggfdaslkvgdivvssevryhdvdltafgyeigqlpan
paafmphddlvaaakkgieqlsqtagenikavtglittgdtfmtkeedvakaranfptma
avemegaaiaqaclqlktpfvvirslsdiagkesphtfeeyletaavnssqlvlnmlgql
kgkvls

Sequence, based on observed residues (ATOM records):

>d5dk6a_ c.56.2.0 (A:) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
lyfqsmkagiigamepevailkekltdakstehagytfhqgqldgsdvvivqsgigkvaa
alatailidrfqvdyvvntgsaggfdaslkvgdivvssevryhdvdltafgyeigqlpan
paafmphddlvaaakkgieqlsqnikavtglittgdtfmtkeedvakaranfptmaavem
egaaiaqaclqlktpfvvirslsdiagkesphtfeeyletaavnssqlvlnmlgqlkgkv
ls

Timeline for d5dk6a_:

• d5dk6a_ is new in SCOPe 2.05-stable
  
• d5dk6a_ is called d5dk6a1 in SCOPe 2.06
  
• d5dk6a_ appears in the current release, SCOPe 2.08, called d5dk6a1