Lineage for d5dled_ (5dle D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851592Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 1851718Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) (S)
  5. 1851740Family c.44.2.0: automated matches [254256] (1 protein)
    not a true family
  6. 1851741Protein automated matches [254590] (4 species)
    not a true protein
  7. 1851742Species Borrelia burgdorferi [TaxId:224326] [278963] (1 PDB entry)
  8. 1851746Domain d5dled_: 5dle D: [278966]
    automated match to d2r48a1
    complexed with cl, imd

Details for d5dled_

PDB Entry: 5dle (more details), 1.55 Å

PDB Description: crystal structure from a domain (thr161-f265) from fructose-specific iiabc component (pts system) from borrelia burgdorferi
PDB Compounds: (D:) Pts system, fructose-specific iiabc component

SCOPe Domain Sequences for d5dled_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dled_ c.44.2.0 (D:) automated matches {Borrelia burgdorferi [TaxId: 224326]}
kaekivavtacpvgvahtyiaakkieneakkqgysirvetqgsigienalteeeiknasv
vilavdkdidekrfegkrvykvstvkainnteniikesfnapvf

SCOPe Domain Coordinates for d5dled_:

Click to download the PDB-style file with coordinates for d5dled_.
(The format of our PDB-style files is described here.)

Timeline for d5dled_: