| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) ![]() |
| Family c.44.2.0: automated matches [254256] (1 protein) not a true family |
| Protein automated matches [254590] (4 species) not a true protein |
| Species Borrelia burgdorferi [TaxId:224326] [278963] (1 PDB entry) |
| Domain d5dled_: 5dle D: [278966] automated match to d2r48a1 complexed with cl, imd |
PDB Entry: 5dle (more details), 1.55 Å
SCOPe Domain Sequences for d5dled_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dled_ c.44.2.0 (D:) automated matches {Borrelia burgdorferi [TaxId: 224326]}
kaekivavtacpvgvahtyiaakkieneakkqgysirvetqgsigienalteeeiknasv
vilavdkdidekrfegkrvykvstvkainnteniikesfnapvf
Timeline for d5dled_: