SCOPe 2.07: Domain d5disc1: 5dis C:-1-73

Lineage for d5disc1 (5dis C:-1-73)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.88: Intrinsically disordered proteins [144255] (2 superfamilies)
   not a true fold

4. Superfamily g.88.2: importin-beta binding (IBB) domain of snurportin-1 [254134] (2 families)

5. Family g.88.2.0: automated matches [278956] (1 protein)
   not a true family

6. Protein automated matches [278957] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [278958] (1 PDB entry)

8. Domain d5disc1: 5dis C:-1-73 [278959]
   Other proteins in same PDB: d5disb_, d5disc2
   automated match to d3gb8b2
   complexed with gtp, mal, mg, pro

Details for d5disc1

PDB Entry: 5dis, 2.85 Å

PDB Description: crystal structure of a crm1-rangtp-spn1 export complex bound to a 113 amino acid fg-repeat containing fragment of nup214

PDB Compounds: (C:) Snurportin-1

SCOPe Domain Sequences for d5disc1:

Sequence, based on SEQRES records:

>d5disc1 g.88.2.0 (C:-1-73) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsmeelsqalassfsvsqdlnstaaphprlsqykskyssleqserrrrllelqkskrldy
vnharrlaeddwtgm

Sequence, based on observed residues (ATOM records):

>d5disc1 g.88.2.0 (C:-1-73) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsmeelsqalassfsvsqdlnstaaphprlkskyssleqserrrrllelqkskrldyvnh
arrlaeddwtgm

Timeline for d5disc1:

• d5disc1 first appeared in SCOPe 2.05
  
• d5disc1 appears in SCOPe 2.06
  
• d5disc1 appears in the current release, SCOPe 2.08