Lineage for d5disc1 (5dis C:1-73)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038910Fold g.88: Intrinsically disordered proteins [144255] (2 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3038916Superfamily g.88.2: importin-beta binding (IBB) domain of snurportin-1 [254134] (2 families) (S)
  5. 3038924Family g.88.2.0: automated matches [278956] (1 protein)
    not a true family
  6. 3038925Protein automated matches [278957] (1 species)
    not a true protein
  7. 3038926Species Human (Homo sapiens) [TaxId:9606] [278958] (1 PDB entry)
  8. 3038927Domain d5disc1: 5dis C:1-73 [278959]
    Other proteins in same PDB: d5disb_, d5disc2, d5disc3
    automated match to d3gb8b2
    complexed with gtp, mg, pro

Details for d5disc1

PDB Entry: 5dis (more details), 2.85 Å

PDB Description: crystal structure of a crm1-rangtp-spn1 export complex bound to a 113 amino acid fg-repeat containing fragment of nup214
PDB Compounds: (C:) Snurportin-1

SCOPe Domain Sequences for d5disc1:

Sequence, based on SEQRES records: (download)

>d5disc1 g.88.2.0 (C:1-73) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meelsqalassfsvsqdlnstaaphprlsqykskyssleqserrrrllelqkskrldyvn
harrlaeddwtgm

Sequence, based on observed residues (ATOM records): (download)

>d5disc1 g.88.2.0 (C:1-73) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meelsqalassfsvsqdlnstaaphprlkskyssleqserrrrllelqkskrldyvnhar
rlaeddwtgm

SCOPe Domain Coordinates for d5disc1:

Click to download the PDB-style file with coordinates for d5disc1.
(The format of our PDB-style files is described here.)

Timeline for d5disc1:

View in 3D
Domains from other chains:
(mouse over for more information)
d5disb_