![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.88: Intrinsically disordered proteins [144255] (2 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily g.88.2: importin-beta binding (IBB) domain of snurportin-1 [254134] (2 families) ![]() |
![]() | Family g.88.2.0: automated matches [278956] (1 protein) not a true family |
![]() | Protein automated matches [278957] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [278958] (1 PDB entry) |
![]() | Domain d5disc1: 5dis C:1-73 [278959] Other proteins in same PDB: d5disb_, d5disc2, d5disc3 automated match to d3gb8b2 complexed with gtp, mg, pro |
PDB Entry: 5dis (more details), 2.85 Å
SCOPe Domain Sequences for d5disc1:
Sequence, based on SEQRES records: (download)
>d5disc1 g.88.2.0 (C:1-73) automated matches {Human (Homo sapiens) [TaxId: 9606]} meelsqalassfsvsqdlnstaaphprlsqykskyssleqserrrrllelqkskrldyvn harrlaeddwtgm
>d5disc1 g.88.2.0 (C:1-73) automated matches {Human (Homo sapiens) [TaxId: 9606]} meelsqalassfsvsqdlnstaaphprlkskyssleqserrrrllelqkskrldyvnhar rlaeddwtgm
Timeline for d5disc1: