SCOPe 2.05: Domain d5d2md_: 5d2m D:

Lineage for d5d2md_ (5d2m D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Human (Homo sapiens), ubc9 [TaxId:9606] [54503] (22 PDB entries)
   identical sequence in many other species

8. Domain d5d2md_: 5d2m D: [278942]
   Other proteins in same PDB: d5d2mb_, d5d2mc_, d5d2me_, d5d2mf_
   automated match to d2pe6a_
   complexed with edo

Details for d5d2md_

PDB Entry: 5d2m, 2.4 Å

PDB Description: complex between human sumo2-rangap1, ubc9 and znf451

PDB Compounds: (D:) SUMO-conjugating enzyme UBC9

SCOPe Domain Sequences for d5d2md_:

Sequence; same for both SEQRES and ATOM records:

>d5d2md_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]}
msgialsrlaqerrawrkdhpfgfvavptknpdgtmnlmnwecaipgkkgtpwegglfkl
rmlfkddypssppkckfepplfhpnvypsgtvclsileedkdwrpaitikqillgiqell
nepniqdpaqaeaytiycqnrveyekrvraqakkfap

Timeline for d5d2md_:

• d5d2md_ is new in SCOPe 2.05-stable
  
• d5d2md_ appears in SCOPe 2.06
  
• d5d2md_ appears in the current release, SCOPe 2.08