Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein SUMO-2 [117816] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117817] (12 PDB entries) Uniprot P61956 |
Domain d5d2me1: 5d2m E:15-93 [278941] Other proteins in same PDB: d5d2ma_, d5d2mc_, d5d2md_, d5d2me2, d5d2mf_ automated match to d2ckhb1 complexed with edo |
PDB Entry: 5d2m (more details), 2.4 Å
SCOPe Domain Sequences for d5d2me1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d2me1 d.15.1.1 (E:15-93) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} ndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpa qlemededtidvfqqqtgg
Timeline for d5d2me1: