SCOPe 2.07: Domain d5d2me1: 5d2m E:15-93

Lineage for d5d2me1 (5d2m E:15-93)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein SUMO-2 [117816] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117817] (12 PDB entries)
   Uniprot P61956

8. Domain d5d2me1: 5d2m E:15-93 [278941]
   Other proteins in same PDB: d5d2ma_, d5d2mc_, d5d2md_, d5d2me2, d5d2mf_
   automated match to d2ckhb1
   complexed with edo

Details for d5d2me1

PDB Entry: 5d2m, 2.4 Å

PDB Description: complex between human sumo2-rangap1, ubc9 and znf451

PDB Compounds: (E:) Small ubiquitin-related modifier 2

SCOPe Domain Sequences for d5d2me1:

Sequence; same for both SEQRES and ATOM records:

>d5d2me1 d.15.1.1 (E:15-93) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}
ndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpa
qlemededtidvfqqqtgg

Timeline for d5d2me1:

• d5d2me1 first appeared in SCOPe 2.05, called d5d2me_
  
• d5d2me1 appears in SCOPe 2.06
  
• d5d2me1 appears in the current release, SCOPe 2.08