Lineage for d5d2me_ (5d2m E:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1892546Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1892759Protein SUMO-2 [117816] (1 species)
  7. 1892760Species Human (Homo sapiens) [TaxId:9606] [117817] (9 PDB entries)
    Uniprot P61956
  8. 1892765Domain d5d2me_: 5d2m E: [278941]
    Other proteins in same PDB: d5d2ma_, d5d2mc_, d5d2md_, d5d2mf_
    automated match to d2ckhb1
    complexed with edo

Details for d5d2me_

PDB Entry: 5d2m (more details), 2.4 Å

PDB Description: complex between human sumo2-rangap1, ubc9 and znf451
PDB Compounds: (E:) Small ubiquitin-related modifier 2

SCOPe Domain Sequences for d5d2me_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d2me_ d.15.1.1 (E:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}
mndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtp
aqlemededtidvfqqqtgg

SCOPe Domain Coordinates for d5d2me_:

Click to download the PDB-style file with coordinates for d5d2me_.
(The format of our PDB-style files is described here.)

Timeline for d5d2me_: