Lineage for d5d2ma_ (5d2m A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939126Species Human (Homo sapiens), ubc9 [TaxId:9606] [54503] (29 PDB entries)
    identical sequence in many other species
  8. 2939151Domain d5d2ma_: 5d2m A: [278940]
    Other proteins in same PDB: d5d2mb_, d5d2mc_, d5d2me1, d5d2me2, d5d2mf_
    automated match to d2pe6a_
    complexed with edo

Details for d5d2ma_

PDB Entry: 5d2m (more details), 2.4 Å

PDB Description: complex between human sumo2-rangap1, ubc9 and znf451
PDB Compounds: (A:) SUMO-conjugating enzyme UBC9

SCOPe Domain Sequences for d5d2ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d2ma_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]}
msgialsrlaqerrawrkdhpfgfvavptknpdgtmnlmnwecaipgkkgtpwegglfkl
rmlfkddypssppkckfepplfhpnvypsgtvclsileedkdwrpaitikqillgiqell
nepniqdpaqaeaytiycqnrveyekrvraqakkfap

SCOPe Domain Coordinates for d5d2ma_:

Click to download the PDB-style file with coordinates for d5d2ma_.
(The format of our PDB-style files is described here.)

Timeline for d5d2ma_: