![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
![]() | Species Human (Homo sapiens), ubc9 [TaxId:9606] [54503] (29 PDB entries) identical sequence in many other species |
![]() | Domain d5d2ma_: 5d2m A: [278940] Other proteins in same PDB: d5d2mb_, d5d2mc_, d5d2me1, d5d2me2, d5d2mf_ automated match to d2pe6a_ complexed with edo |
PDB Entry: 5d2m (more details), 2.4 Å
SCOPe Domain Sequences for d5d2ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d2ma_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} msgialsrlaqerrawrkdhpfgfvavptknpdgtmnlmnwecaipgkkgtpwegglfkl rmlfkddypssppkckfepplfhpnvypsgtvclsileedkdwrpaitikqillgiqell nepniqdpaqaeaytiycqnrveyekrvraqakkfap
Timeline for d5d2ma_: